PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.19424s0870.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 351aa    MW: 39863.4 Da    PI: 8.04
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.19424s0870.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.77.5e-2275134357
                           --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                           +R+++t++ql++Leel+++ +r+psa+++++++++l    +++ ++V++WFqN++a+e++
  Bostr.19424s0870.1.p  75 SRWNPTPDQLRVLEELYRQgTRTPSADHIQQITAQLrrygKIEGKNVFYWFQNHKARERQ 134
                           7*****************99**************************************97 PP

2Wus_type_Homeobox117.94.5e-3874136365
     Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                           ++RW+Ptp+Q+++Leely++G+rtP++++iq+ita+L++yGkie+kNVfyWFQN+kaRerqk+
  Bostr.19424s0870.1.p  74 SSRWNPTPDQLRVLEELYRQGTRTPSADHIQQITAQLRRYGKIEGKNVFYWFQNHKARERQKR 136
                           79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.1E-572139IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-975134IPR009057Homeodomain-like
PfamPF000461.5E-1975134IPR001356Homeobox domain
SuperFamilySSF466896.53E-1275140IPR009057Homeodomain-like
CDDcd000868.94E-676136No hitNo description
PROSITE profilePS5007110.86780135IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MWTMDYNEGG ADSFNGGRKL RPLIPRLSSC PTAASNTNSD HRFNMAVMTM TAEQNKRELM  60
MLNSEPQHPP VMVSSRWNPT PDQLRVLEEL YRQGTRTPSA DHIQQITAQL RRYGKIEGKN  120
VFYWFQNHKA RERQKRRRQM ETGNEESVLT TTSLVPNHGF DKKDPPGYKV EQAKNWICSV  180
GCDTQPEKPS HDDHQEEAAN IRVERNGRCG GDERRSFLGR NVAWQMMQLP PGLYPSSHHH  240
QRNLILNSTT VSSNISTSNI NTVSAAKDTV TFSPAFLSTR AATNAKTCRL NCDANKDQER  300
HEQCSNGESD HQEQTLELFP LRKEGVSSDG EKEKEISGNH CFYEFLPLKN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2513940.0AY251394.1 Arabidopsis thaliana WOX1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010465873.10.0PREDICTED: WUSCHEL-related homeobox 1-like isoform X1
SwissprotQ6X7K00.0WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLD7L7Y50.0D7L7Y5_ARALL; WOX1 protein
STRINGfgenesh2_kg.3__1989__AT3G18010.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM73972741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.10.0WUSCHEL related homeobox 1